PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00131.1_g00058.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family S1Fa-like
Protein Properties Length: 70aa    MW: 7761.56 Da    PI: 11.1191
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00131.1_g00058.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA135.51.3e-42270270
                     S1FA  2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                             +++k+e+kGlnPGliv+lv+ggll++flvgn++ly+yaqknlPPrkkkP+skkk+k+eklk+Gv+vPGe
  Rsa1.0_00131.1_g00058.1  2 KQGKIESKGLNPGLIVILVIGGLLVTFLVGNFVLYTYAQKNLPPRKKKPLSKKKMKKEKLKKGVQVPGE 70
                             5789****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190131.0E-4540No hitNo description
PfamPF046894.7E-38670IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MKQGKIESKG LNPGLIVILV IGGLLVTFLV GNFVLYTYAQ KNLPPRKKKP LSKKKMKKEK  60
LKKGVQVPGE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0166613e-58AC016661.7 Arabidopsis thaliana chromosome 3 BAC F11F8 genomic sequence, complete sequence.
GenBankCP0026863e-58CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.11e-23DNA-binding protein S1FA1
SwissprotQ423371e-18S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLA0A087H8A93e-24A0A087H8A9_ARAAL; Uncharacterized protein
STRINGBra034084.1-P2e-23(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09735.13e-11S1FA-like DNA-binding protein